PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A09G0901
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 391aa    MW: 43276.8 Da    PI: 10.1499
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A09G0901genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.27.6e-13307358556
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                  +r+rr++kNRe+A rsR+RK+a++ eLe +  +L++eN +Lk+ +ee +++ 
  Gh_A09G0901 307 RRQRRMIKNRESAARSRARKQAYTVELELELNQLKQENAKLKQLVEENEQKR 358
                  69************************************98884444443333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.3E-10303369IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.921305357IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.8E-12306358No hitNo description
CDDcd147078.95E-24307354No hitNo description
PfamPF001703.4E-10307359IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.13E-10307356No hitNo description
PROSITE patternPS000360310325IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MALFASESVA YGGIKAASPS QAPRSPQQQQ RQELTQDQSV SSLNKQGSIF SLTLDEIQLK  60
SGKAFGSMNM DEFLANLWNV EENQAPPQLD QNEARDDKDK GNGGQPTLAR QGSFSIPTPL  120
CKKTVDEVWF EIQKELPQQR KANNIADHEP PQRQQTFGEM TLEDFLIKAG VVQEPSSASS  180
QQKKVASTRT NGTSLEATYG MGHGAGSSQQ KMLTSIQNSS ASLDANFGMG HVMGLGFPGH  240
QIVPSNLAAP GNGYAAAYPI FTQSKTMMGE SSNVAENGNG TNRLLEPVVI QNKKRIIDGP  300
PEVVVERRQR RMIKNRESAA RSRARKQAYT VELELELNQL KQENAKLKQL VEENEQKRKQ  360
EVLKRKQSKL PAQRKVVDKM RTLRRTVSLG W
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012485099.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1
TrEMBLA0A0B0PST60.0A0A0B0PST6_G
STRINGPOPTR_0009s16610.11e-121(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116522230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44460.16e-61bZIP family protein